SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17149830|ref|NP_476510.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17149830|ref|NP_476510.1|
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-30
Family Pyk2-associated protein beta ARF-GAP domain 0.0021
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|17149830|ref|NP_476510.1|
Domain Number - Region: 433-497
Classification Level Classification E-value
Superfamily OmpH-like 0.0732
Family OmpH-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17149830|ref|NP_476510.1|
Sequence length 759
Comment ARF GTPase-activating protein GIT2 isoform 1 [Homo sapiens]
Sequence
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDME
PDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences Q14161
ENSP00000347464 ENSP00000353312 ENSP00000347464 9606.ENSP00000347464 NP_476510.1.87134 NP_476510.1.92137 gi|17149830|ref|NP_476510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]