SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17157993|ref|NP_477512.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17157993|ref|NP_477512.1|
Domain Number - Region: 208-368
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0365
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17157993|ref|NP_477512.1|
Sequence length 454
Comment noelin-2 precursor [Homo sapiens]
Sequence
MWPLTVPPPLLLLLCSGLAGQTLFQNPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDG
RSRELRQLMEKVQNVSQSMEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQ
ELKDRMTELLPLSSVLEQYKADTRTIVRLREEVRNLSGSLAAIQEEMGAYGYEDLQQRVM
ALEARLHACAQKLGCGKLTGVSNPITVRAMGSRFGSWMTDTMAPSADSRVWYMDGYYKGR
RVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLV
QRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVMRS
WDTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISML
DYNPRERALYTWNNGHQVLYNVTLFHVISTSGDP
Download sequence
Identical sequences O95897
NYSGRC-17157993 ENSP00000264833 9606.ENSP00000264833 ENSP00000264833 NP_477512.1.87134 NP_477512.1.92137 gi|17157993|ref|NP_477512.1| ENSP00000264833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]