SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17975768|ref|NP_004434.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17975768|ref|NP_004434.2|
Domain Number 1 Region: 626-925
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-80
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 39-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-72
Family Ephrin receptor ligand binding domain 0.000000224
Further Details:      
 
Domain Number 3 Region: 338-543
Classification Level Classification E-value
Superfamily Fibronectin type III 6.87e-40
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 922-995
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  gi|17975768|ref|NP_004434.2|
Domain Number - Region: 266-342,377-395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000235
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17975768|ref|NP_004434.2|
Sequence length 998
Comment ephrin type-B receptor 3 precursor [Homo sapiens]
Sequence
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences P54753
ENSP00000332118 ENSP00000332118 ENSP00000332118 gi|17975768|ref|NP_004434.2| 9606.ENSP00000332118 NP_004434.2.87134 NP_004434.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]