SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17981694|ref|NP_004927.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17981694|ref|NP_004927.2|
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.33e-50
Family Ankyrin repeat 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17981694|ref|NP_004927.2|
Sequence length 138
Comment cyclin-dependent kinase 4 inhibitor B isoform 1 [Homo sapiens]
Sequence
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVAGYLRTATGD
Download sequence
Identical sequences G2HH14 K7PPU3 P42772
ENSP00000276925 ENSP00000276925 NP_004927.2.87134 NP_004927.2.92137 XP_003830735.1.60992 XP_009454660.2.37143 ENSP00000276925 9598.ENSPTRP00000035618 9606.ENSP00000276925 gi|17981694|ref|NP_004927.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]