SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17981696|ref|NP_511042.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17981696|ref|NP_511042.1|
Domain Number 1 Region: 17-56
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000527
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17981696|ref|NP_511042.1|
Sequence length 78
Comment cyclin-dependent kinase 4 inhibitor B isoform 2 [Homo sapiens]
Sequence
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVAGAPGPR
RQGARERGARPRRIGAGT
Download sequence
Identical sequences A0A2J8QSM4
NP_511042.1.87134 NP_511042.1.92137 XP_008954346.1.60992 ENSP00000369487 ENSP00000445136 ENSP00000369487 gi|17981696|ref|NP_511042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]