SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18034767|ref|NP_071387.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18034767|ref|NP_071387.1|
Domain Number 1 Region: 41-76
Classification Level Classification E-value
Superfamily WW domain 0.0000000415
Family WW domain 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|18034767|ref|NP_071387.1|
Domain Number - Region: 305-349
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0011
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18034767|ref|NP_071387.1|
Sequence length 704
Comment phosphorylated CTD-interacting factor 1 [Homo sapiens]
Sequence
MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRP
YYFNRFTNQSLWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPPAENKPRKRQLSEEQP
SGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDI
QTNAVIKHRGPSEVLPPHPEVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLER
KVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIE
SRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGI
CSKIYHISLEYVKRIREKHLAILKENNISEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFG
VGLYEGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPC
LDFAPLSGSFEANPPFCEELMDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRME
QSRFKRHQLILPAFEHEYRSGSQHICKKEEMHYKAVHNTAVLFLQNDPGFAKWAPTPERL
QELSAAYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSREPHPT
Download sequence
Identical sequences H2QKH7 Q9H4Z3
gi|18034767|ref|NP_071387.1| NP_071387.1.87134 NP_071387.1.92137 XP_003826044.1.60992 XP_011527282.1.92137 XP_011527283.1.92137 XP_016793508.1.37143 XP_016793509.1.37143 XP_016883502.1.92137 XP_514687.2.37143 ENSP00000361486 9598.ENSPTRP00000023321 9606.ENSP00000361486 HR5447 ENSP00000361486 ENSP00000361486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]