SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18254474|ref|NP_543149.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18254474|ref|NP_543149.1|
Domain Number 1 Region: 39-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.56e-51
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 280-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000017
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18254474|ref|NP_543149.1|
Sequence length 323
Comment ankyrin repeat and SOCS box protein 11 isoform a [Homo sapiens]
Sequence
MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLEN
GAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECME
ILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSN
VEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLG
RACHQAIHKLHLPEPLERFLLYQ
Download sequence
Identical sequences Q8WXH4
9606.ENSP00000417914 ENSP00000417914 gi|18254474|ref|NP_543149.1| ENSP00000417914 ENSP00000417914 NP_543149.1.87134 NP_543149.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]