SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18390333|ref|NP_569058.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18390333|ref|NP_569058.1|
Domain Number 1 Region: 24-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.17e-20
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 240-291
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000288
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18390333|ref|NP_569058.1|
Sequence length 302
Comment ankyrin repeat and SOCS box protein 14 isoform 2 [Homo sapiens]
Sequence
MLKCILKFFLRALKILIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLD
QRINKHYDDHRKSALYFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLL
LRHGANVNYFCRVNPLHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTV
EGWTSTVIKDTKFCEVITLSWLQHLSGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIH
FILTNPRSLKHLCRLKIRKCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGQGIFTG
TW
Download sequence
Identical sequences gi|18390333|ref|NP_569058.1| NP_569058.1.87134 NP_569058.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]