SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18426967|ref|NP_550438.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18426967|ref|NP_550438.1|
Domain Number 1 Region: 38-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.32e-40
Family Nucleotide and nucleoside kinases 0.00000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18426967|ref|NP_550438.1|
Sequence length 277
Comment deoxyguanosine kinase, mitochondrial isoform a precursor [Homo sapiens]
Sequence
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTK
TYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLK
VQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEF
ASRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTTKLHFE
ALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL
Download sequence
Identical sequences E5KSL5 Q16854
ENSP00000264093 NP_550438.1.87134 NP_550438.1.92137 gi|18426967|ref|NP_550438.1| 9606.ENSP00000264093 ENSP00000264093 ENSP00000264093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]