SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18496983|ref|NP_056341.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18496983|ref|NP_056341.1|
Domain Number 1 Region: 410-545
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-41
Family Cap-Gly domain 0.0000061
Further Details:      
 
Domain Number 2 Region: 266-393
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.97e-39
Family Cap-Gly domain 0.0000115
Further Details:      
 
Domain Number 3 Region: 101-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-17
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18496983|ref|NP_056341.1|
Sequence length 547
Comment CAP-Gly domain-containing linker protein 3 [Homo sapiens]
Sequence
MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFF
DPNDPACQEILFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMT
LLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVL
LKGARPRVVNSTCSDFNHGSALHIAASSLCLGAAKCLLEHGANPALRNRKGQVPAEVVPD
PMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRLGDRV
LLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKI
SKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGD
QVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPAS
RIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWM
LRAEMQS
Download sequence
Identical sequences G3QF13 H2NYJ4 K7CJ19 Q96DZ5
ENSPPYP00000011075 ENSP00000353732 ENSP00000466832 NP_001186499.1.87134 NP_001186499.1.92137 NP_056341.1.87134 NP_056341.1.92137 XP_003816147.1.60992 XP_009230747.1.23681 XP_016791229.1.37143 XP_018871160.1.27298 gi|18496983|ref|NP_056341.1| gi|313851097|ref|NP_001186499.1| 9600.ENSPPYP00000011075 9606.ENSP00000353732 ENSPPYP00000011075 ENSP00000353732 ENSP00000353732 ENSP00000466832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]