SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18640734|ref|NP_570129.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18640734|ref|NP_570129.1|
Domain Number 1 Region: 38-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00065
Further Details:      
 
Domain Number 2 Region: 150-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-39
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 3 Region: 351-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-35
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 4 Region: 723-738,774-936
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.29e-35
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 967-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-30
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 6 Region: 577-634
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000131
Family Fibrinogen C-terminal domain-like 0.0053
Further Details:      
 
Domain Number 7 Region: 548-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18640734|ref|NP_570129.1|
Sequence length 1306
Comment contactin-associated protein-like 5 precursor [Homo sapiens]
Sequence
MDSLPRLTSVLTLLFSGLWHLGLTATNYNCDDPLASLLSPMAFSSSSDLTGTHSPAQLNW
RVGTGGWSPADSNAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVVHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQKGRLAL
HLNLGDSKARLSSSLPSATLGSLLDDQHWHSVLIERVGKQVNFTVDKHTQHFRTKGETDA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTGNVTFSC
SEPQIVPITFVNSSGSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSEGSGTLLLSL
EGGILRLVIQKMTERVAEILTGSNLNDGLWHSVSINARRNRITLTLDDEAAPPAPDSTWV
QIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHGGSCSQSWTTFYCNCSDTSYTGATCHNSIYEQSCEVYRHQGNT
AGFFYIDSDGSGPLGPLQVYCNITEDKIWTSVQHNNTELTRVRGANPEKPYAMALDYGGS
MEQLEAVIDGSEHCEQEVAYHCRRSRLLNTPDGTPFTWWIGRSNERHPYWGGSPPGVQQC
ECGLDESCLDIQHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTDRSNSEAAWRIGP
LRCYGDRRFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRL
EISSPSEITFAIDVGNGPVELVVQSPSLLNDNQWHYVRAERNLKETSLQVDNLPRSTRET
SEEGHFRLQLNSQLFVGGTSSRQKGFLGCIRSLHLNGQKMDLEERAKVTSGVRPGCPGHC
SSYGSICHNGGKCVEKHNGYLCDCTNSPYEGPFCKKEVSAVFEAGTSVTYMFQEPYPVTK
NISLSSSAIYTDSAPSKENIALSFVTTQAPSLLLFINSSSQDFVVVLLCKNGSLQVRYHL
NKEETHVFTIDADNFANRRMHHLKINREGRELTIQMDQQLRLSYNFSPEVEFRVIRSLTL
GKVTENLGLDSEVAKANAMGFAGCMSSVQYNHIAPLKAALRHATVAPVTVHGTLTESSCG
FMVDSDVNAVTTVHSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFCIIGIMTR
FLYQHKQSHRTSQMKEKEYPENLDSSFRNEIDLQNTVSECKREYFI
Download sequence
Identical sequences Q8WYK1
ENSP00000399013 NP_570129.1.87134 NP_570129.1.92137 gi|18640734|ref|NP_570129.1| 9606.ENSP00000399013 ENSP00000399013 ENSP00000399013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]