SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18640738|ref|NP_570124.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18640738|ref|NP_570124.1|
Domain Number 1 Region: 53-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-44
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000143
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 
Domain Number 3 Region: 245-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000157
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Weak hits

Sequence:  gi|18640738|ref|NP_570124.1|
Domain Number - Region: 354-459
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00732
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18640738|ref|NP_570124.1|
Sequence length 475
Comment ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 [Homo sapiens]
Sequence
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVS
LVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFL
LKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK
DLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK
Download sequence
Identical sequences Q8WWH4
gi|18640738|ref|NP_570124.1| NP_570124.1.87134 NP_570124.1.92137 ENSP00000284629 9606.ENSP00000284629 ENSP00000284629 ENSP00000284629 HR6125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]