SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186972132|ref|NP_001119583.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186972132|ref|NP_001119583.1|
Domain Number 1 Region: 60-81,168-245,295-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000647
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  gi|186972132|ref|NP_001119583.1|
Domain Number - Region: 56-96,292-361,415-526
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00418
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186972132|ref|NP_001119583.1|
Sequence length 549
Comment oxidative stress-induced growth inhibitor 2 isoform 1 [Homo sapiens]
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVT
FPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEG
SMLTISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYRDQDDDDIQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAE
NVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADA
VLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYT
SFPEHRVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQP
ITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFV
ERGGGDGIA
Download sequence
Identical sequences 9606.ENSP00000396445 ENSP00000297438 ENSP00000396445 ENSP00000396445 NP_001119583.1.87134 NP_001119583.1.92137 gi|186972132|ref|NP_001119583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]