SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188497750|ref|NP_277035.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188497750|ref|NP_277035.2|
Domain Number 1 Region: 660-899
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.05e-86
Family Hexokinase 0.000000000628
Further Details:      
 
Domain Number 2 Region: 211-451
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.3e-85
Family Hexokinase 0.000000000714
Further Details:      
 
Domain Number 3 Region: 442-656
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.8e-80
Family Hexokinase 0.00000000505
Further Details:      
 
Domain Number 4 Region: 7-209
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.91e-76
Family Hexokinase 0.00000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188497750|ref|NP_277035.2|
Sequence length 905
Comment hexokinase-1 isoform HKI-td [Homo sapiens]
Sequence
MAKRALHDFIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIP
DGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAE
CLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKA
IKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDE
GRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVK
MAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQ
HVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLR
RLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMR
AEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRT
VEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLD
AGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTC
EVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEY
SLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIES
DRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLD
RLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLR
TEASS
Download sequence
Identical sequences ENSP00000353433 ENSP00000353433 gi|188497750|ref|NP_277035.2| NP_277035.2.87134 NP_277035.2.92137 XP_011538034.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]