SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188497754|ref|NP_000179.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188497754|ref|NP_000179.2|
Domain Number 1 Region: 672-911
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.61e-152
Family Hexokinase 0.00044
Further Details:      
 
Domain Number 2 Region: 224-466
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.64e-151
Family Hexokinase 0.0000666
Further Details:      
 
Domain Number 3 Region: 465-670
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.51e-131
Family Hexokinase 0.0000784
Further Details:      
 
Domain Number 4 Region: 14-221
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.16e-119
Family Hexokinase 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188497754|ref|NP_000179.2|
Sequence length 917
Comment hexokinase-1 isoform HKI [Homo sapiens]
Sequence
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
Download sequence
Identical sequences P19367
gi|188497754|ref|NP_000179.2| ENSP00000352398 NP_000179.2.87134 NP_000179.2.92137 1hkb_A 1hkb_B 4foe_A 4foe_B 4fpb_A 4fpb_B ENSP00000352398 1hkbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]