SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18860918|ref|NP_005099.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18860918|ref|NP_005099.2|
Domain Number 1 Region: 10-287
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.08e-38
Family Glycerol kinase 0.025
Further Details:      
 
Domain Number 2 Region: 290-523
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.29e-32
Family Glycerol kinase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18860918|ref|NP_005099.2|
Sequence length 536
Comment xylulose kinase [Homo sapiens]
Sequence
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLT
VTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLR
LHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIY
QQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPH
LEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLG
TSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSK
ALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHG
LAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE
Download sequence
Identical sequences O75191
ENSP00000207870 gi|18860918|ref|NP_005099.2| Hs18860918___KOG2531 ENSP00000398845 9606.ENSP00000207870 NP_005099.2.87134 NP_005099.2.92137 ENSP00000207870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]