SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189217411|ref|NP_899229.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189217411|ref|NP_899229.2|
Domain Number 1 Region: 14-147
Classification Level Classification E-value
Superfamily PX domain 5.72e-21
Family PX domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189217411|ref|NP_899229.2|
Sequence length 231
Comment PX domain-containing protein C6orf145 [Homo sapiens]
Sequence
MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADL
GRLWQRLRDAFPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRS
EVVLTFFERSPLDQVLKNDNVHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNG
RDQQLGVDPTEHLFENGSEFPSELEDGDDPAAYVTNLSYYHLVPFETDIWD
Download sequence
Identical sequences Q5TGL8
gi|189217411|ref|NP_899229.2| NP_899229.2.87134 NP_899229.2.92137 ENSP00000369636 9606.ENSP00000369636 ENSP00000369630 ENSP00000369636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]