SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189217428|ref|NP_001121190.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189217428|ref|NP_001121190.1|
Domain Number 1 Region: 1492-1667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-32
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 1322-1485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 923-1095
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-20
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 1094-1263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-19
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 5 Region: 722-913
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000336
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 78-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 7 Region: 130-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000879
Family Laminin-type module 0.048
Further Details:      
 
Weak hits

Sequence:  gi|189217428|ref|NP_001121190.1|
Domain Number - Region: 252-494
Classification Level Classification E-value
Superfamily Tropomyosin 0.000294
Family Tropomyosin 0.008
Further Details:      
 
Domain Number - Region: 435-658
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00549
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189217428|ref|NP_001121190.1|
Sequence length 1668
Comment laminin subunit alpha-3 isoform 4 [Homo sapiens]
Sequence
MPPAVRRSACSMGWLWIFGAALGQCLGYSSQQQRVPFLQPPGQSQLQASYVEFRPSQGCS
PGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHG
SCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSC
NSNGQLGSCHPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQG
LSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKA
QVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHMLNRIRTWQKTHQGENNGLANSIR
DSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLT
TADSSLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKH
ARSLQELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQ
TVIKEDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTN
LTTLRDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQN
EDFKKALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAAS
KVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDAS
RDYIGMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTK
GATSSKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELD
DLNENVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQT
IQTTVDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIK
IGKLQKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTS
GVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGI
LLDHQTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLID
DQLLRNSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLG
GCSLNKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHG
ALQFGDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLV
FALGTDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAP
VYLGSPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEG
GHVVLAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGG
TSTSVTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAP
ANLTTLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
Download sequence
Identical sequences gi|189217428|ref|NP_001121190.1| ENSP00000466557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]