SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189409120|ref|NP_001121599.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189409120|ref|NP_001121599.1|
Domain Number 1 Region: 13-269
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.91e-81
Family Glycerol kinase 0.00000101
Further Details:      
 
Domain Number 2 Region: 268-514
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.85e-74
Family Glycerol kinase 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189409120|ref|NP_001121599.1|
Sequence length 553
Comment glycerol kinase isoform c [Homo sapiens]
Sequence
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSM
VMLIGARYISGIP
Download sequence
Identical sequences A0A1D5QW52 A0A2I2ZR50 A0A2I3FWY7 A0A2I3N010 A0A2K5KYY5 A0A2K5TMQ3 A0A2K5XNA7 A0A2K6D8W7 K7BRM9
ENSP00000368226 ENSP00000368224 gi|189409120|ref|NP_001121599.1| 9606.ENSP00000368226 ENSP00000368226 NP_001121599.1.87134 NP_001121599.1.92137 XP_003261228.1.23891 XP_003317452.1.37143 XP_005593291.1.63531 XP_007989546.1.81039 XP_011754179.1.29376 XP_011826082.1.47321 XP_011890976.1.92194 XP_014982617.1.72884 XP_016799178.1.37143 XP_018875296.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]