SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190684675|ref|NP_006288.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190684675|ref|NP_006288.2|
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.24e-65
Family N-terminal domain of xrcc1 0.0000000837
Further Details:      
 
Domain Number 2 Region: 539-629
Classification Level Classification E-value
Superfamily BRCT domain 1.83e-22
Family DNA-repair protein XRCC1 0.00000643
Further Details:      
 
Domain Number 3 Region: 319-403
Classification Level Classification E-value
Superfamily BRCT domain 5.63e-22
Family BRCT domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190684675|ref|NP_006288.2|
Sequence length 633
Comment DNA repair protein XRCC1 [Homo sapiens]
Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR
GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG
SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN
GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP
DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD
NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences gi|190684675|ref|NP_006288.2| NP_006288.2.87134 NP_006288.2.92137 ENSP00000262887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]