SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194018403|ref|NP_001123453.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194018403|ref|NP_001123453.1|
Domain Number 1 Region: 149-297
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-39
Family Ankyrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194018403|ref|NP_001123453.1|
Sequence length 327
Comment ankyrin repeat domain-containing protein 2 isoform b [Homo sapiens]
Sequence
MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRG
DARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRK
KRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQF
RRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADT
NVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEH
PEPGAEHNGLEGPNDSGRETPQPVPAQ
Download sequence
Identical sequences gi|194018403|ref|NP_001123453.1| ENSP00000298808 ENSP00000298808 NP_001123453.1.87134 NP_001123453.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]