SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194097332|ref|NP_004436.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194097332|ref|NP_004436.2|
Domain Number 1 Region: 667-923
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.52e-59
Family Protein kinases, catalytic subunit 0.0000000717
Further Details:      
 
Domain Number 2 Region: 33-228
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-54
Family Ephrin receptor ligand binding domain 0.00000553
Further Details:      
 
Domain Number 3 Region: 368-581
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-33
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 4 Region: 947-1018
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.44e-17
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 
Domain Number 5 Region: 297-361,407-428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000272
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194097332|ref|NP_004436.2|
Sequence length 1021
Comment ephrin type-B receptor 6 precursor [Homo sapiens]
Sequence
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWA
VGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFA
SFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCR
CQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSD
PPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGG
GGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAIN
VSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTS
ETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSI
LGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRE
LAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRA
AVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVA
AAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTT
SSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQK
DRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAI
GLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVE
V
Download sequence
Identical sequences O15197
ENSP00000376684 gi|194097332|ref|NP_004436.2| 9606.ENSP00000376684 ENSP00000376684 ENSP00000410789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]