SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194097375|ref|NP_872414.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194097375|ref|NP_872414.3|
Domain Number 1 Region: 98-241
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-25
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194097375|ref|NP_872414.3|
Sequence length 452
Comment ankyrin repeat domain-containing protein 33 isoform 2 [Homo sapiens]
Sequence
MKVQPSVTCVASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLL
VPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQLQAILDGGVS
PEEATQVDSNGRTGLMVACYHGFQSVVALLSHCPFLDVNQQDKGGDTALMLAAQAGHVPL
VSLLLNYYVGLDLERRDQRGLTALMKAAMRNRCADLTAVDPVRGKTALEWAVLTDSFDTV
WRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQ
EGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLGTAPPPPLVPQSPP
GSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSP
SGHQSLALPLWRYQELRIEKRKQEEEARMAQK
Download sequence
Identical sequences Q7Z3H0
gi|194097375|ref|NP_872414.3| 9606.ENSP00000301190 ENSP00000301190 ENSP00000301190 NP_872414.3.87134 NP_872414.3.92137 ENSP00000301190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]