SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194097462|ref|NP_848620.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194097462|ref|NP_848620.2|
Domain Number 1 Region: 189-416
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.11e-67
Family Actin/HSP70 0.0000032
Further Details:      
 
Domain Number 2 Region: 49-196
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.37e-40
Family Actin/HSP70 0.0000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194097462|ref|NP_848620.2|
Sequence length 416
Comment actin-like protein 9 [Homo sapiens]
Sequence
MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGVVVIDMGTGT
CKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPELTLVQPLRSGIVV
DWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQ
SVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNHLTAFLAEMLLQAG
LPLGQQDLDLVENIKHHYCYVASDFQKEQARPEQEYKRTLKLPDGRTVTLGKELFQCPEL
LFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQNVLLCGGSSLFTGFEGRFRAELLR
ALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSCWVLREQYEEQGPYIVYRKCY
Download sequence
Identical sequences A0A140VJD5 Q8TC94
gi|194097462|ref|NP_848620.2| 9606.ENSP00000316674 ENSP00000316674 ENSP00000316674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]