SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194248072|ref|NP_005336.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194248072|ref|NP_005336.3|
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.96e-73
Family Actin/HSP70 0.000000013
Further Details:      
 
Domain Number 2 Region: 190-382
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.12e-70
Family Actin/HSP70 0.00000000931
Further Details:      
 
Domain Number 3 Region: 386-543
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.44e-65
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000000888
Further Details:      
 
Domain Number 4 Region: 538-619
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 3.14e-30
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194248072|ref|NP_005336.3|
Sequence length 641
Comment heat shock 70 kDa protein 1A/1B [Homo sapiens]
Sequence
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
Download sequence
Identical sequences A0A0D9SD81 A0A2J8NY10 A0A2J8R4J8 A8K5I0 G7MRK7 G8F3W4 P0DMV8 P0DMV9 Q5R7D3
ENSPPYP00000018408 ENSP00000364801 ENSP00000364802 ENSP00000375391 ENSP00000375399 ENSP00000393087 ENSP00000403530 ENSP00000404524 ENSP00000406359 ENSP00000408907 9600.ENSPPYP00000018408 9606.ENSP00000364801 9606.ENSP00000364802 9606.ENSP00000375391 9606.ENSP00000375399 9606.ENSP00000393087 9606.ENSP00000403530 9606.ENSP00000404524 9606.ENSP00000406359 9606.ENSP00000408907 ENSP00000364801 ENSP00000364802 ENSP00000375391 ENSP00000375399 ENSP00000393087 ENSP00000403530 ENSP00000404524 ENSP00000406359 ENSP00000408907 ENSGGOP00000005646 ENSGGOP00000019277 ENSP00000364801 ENSP00000364803 ENSP00000375391 ENSP00000375399 ENSP00000393087 ENSP00000403530 ENSP00000408907 ENSP00000410693 ENSP00000415927 NP_001270918.1.63531 NP_005336.3.87134 NP_005336.3.92137 NP_005337.2.87134 NP_005337.2.92137 XP_004043739.1.27298 XP_007971270.1.81039 XP_007971273.1.81039 XP_010381641.1.97406 XP_011767126.1.29376 XP_011800126.1.43180 XP_011855914.1.47321 XP_011855915.1.47321 XP_011888326.1.92194 XP_015304284.1.63531 XP_015304285.1.63531 XP_016810679.1.37143 XP_016810680.1.37143 XP_017714974.1.44346 XP_018884439.1.27298 ENSGGOP00000005646 ENSGGOP00000019277 gi|167466173|ref|NP_005337.2| gi|194248072|ref|NP_005336.3| ENSPPYP00000018408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]