SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194294540|ref|NP_057060.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194294540|ref|NP_057060.2|
Domain Number 1 Region: 95-212
Classification Level Classification E-value
Superfamily PX domain 6.28e-32
Family PX domain 0.00046
Further Details:      
 
Weak hits

Sequence:  gi|194294540|ref|NP_057060.2|
Domain Number - Region: 247-435
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000298
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194294540|ref|NP_057060.2|
Sequence length 451
Comment sorting nexin-7 isoform a [Homo sapiens]
Sequence
MEGERRASQAPSSGLPAGGANGESPGGGAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSK
DASLMDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIIT
KTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIET
RRKALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSM
RGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHILWSASEE
DLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELD
SKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEEN
IHYYEQCLATWESFLTSQTNLHLEEASEDKP
Download sequence
Identical sequences ENSP00000304429 ENSP00000304429 NP_057060.2.87134 NP_057060.2.92137 ENSP00000304429 gi|194294540|ref|NP_057060.2| 9606.ENSP00000304429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]