SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194306651|ref|NP_060460.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194306651|ref|NP_060460.4|
Domain Number 1 Region: 455-763
Classification Level Classification E-value
Superfamily Folate-binding domain 1.21e-81
Family Aminomethyltransferase folate-binding domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 43-258,363-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.88e-54
Family FAD-linked reductases, N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 260-362
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.28e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 4 Region: 765-858
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000213
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194306651|ref|NP_060460.4|
Sequence length 879
Comment pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial precursor [Homo sapiens]
Sequence
MMFYRLLSIVGRQRASPGWQNWSSARNSTSAAEARSMALPTQAQVVICGGGITGTSVAYH
LSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYYQLEQETGIQT
GYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNC
AGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGI
LSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPET
FTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRF
GALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFE
RPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQ
ALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQQVHCWA
WLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGY
ANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFA
FWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDSDLD
LWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEY
EIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLHGK
Download sequence
Identical sequences Q8NCN5
ENSP00000288050 gi|194306651|ref|NP_060460.4| ENSP00000288050 ENSP00000457916 NP_001309046.1.87134 NP_001309046.1.92137 NP_060460.4.87134 NP_060460.4.92137 XP_005256072.1.92137 XP_005256073.1.92137 XP_016878876.1.92137 ENSP00000288050 ENSP00000457916 9606.ENSP00000288050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]