SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|195947376|ref|NP_997309.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195947376|ref|NP_997309.2|
Domain Number 1 Region: 101-196
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.52e-40
Family Forkhead DNA-binding domain 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|195947376|ref|NP_997309.2|
Sequence length 318
Comment forkhead box protein I2 [Homo sapiens]
Sequence
MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPA
PPYAAPSYGAPGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPL
RKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDP
NCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPE
AATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTA
AAGFRLSHLLYSREGTEV
Download sequence
Identical sequences Q6ZQN5
gi|195947376|ref|NP_997309.2| ENSP00000373572 ENSP00000373572 NP_997309.2.87134 NP_997309.2.92137 9606.ENSP00000373572 ENSP00000373572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]