SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197304746|ref|NP_001127878.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197304746|ref|NP_001127878.1|
Domain Number 1 Region: 31-193
Classification Level Classification E-value
Superfamily RUN domain-like 7.06e-46
Family RUN domain 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197304746|ref|NP_001127878.1|
Sequence length 407
Comment RUN domain-containing protein 3B isoform c [Homo sapiens]
Sequence
MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSS
PEFNNFAAILEQILSHRLKGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSS
SRAKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAI
DFSFCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPP
FLMDENSWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLA
HKLEKEQLEYIIVELQDQLKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEG
KEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS
Download sequence
Identical sequences A0A2I3TUT6 A0A2J8WKA7
ENSP00000420394 gi|197304746|ref|NP_001127878.1| NP_001127878.1.87134 NP_001127878.1.92137 XP_003951116.1.37143 XP_008974556.1.60992 XP_009241320.1.23681 ENSP00000420394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]