SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197333695|ref|NP_001127949.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197333695|ref|NP_001127949.1|
Domain Number 1 Region: 3-73,205-342
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.36e-50
Family CAF1-like ribonuclease 0.058
Further Details:      
 
Domain Number 2 Region: 109-194
Classification Level Classification E-value
Superfamily R3H domain 7.26e-34
Family R3H domain 0.0000149
Further Details:      
 
Domain Number 3 Region: 370-460
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000108
Family Canonical RBD 0.00000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197333695|ref|NP_001127949.1|
Sequence length 578
Comment poly(A)-specific ribonuclease PARN isoform 2 [Homo sapiens]
Sequence
MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGF
DFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFI
DQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVI
SKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFY
CPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVE
SAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNK
LFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSA
FVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNP
QCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPL
SEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
Download sequence
Identical sequences NP_001127949.1.87134 NP_001127949.1.92137 ENSP00000345456 gi|197333695|ref|NP_001127949.1| ENSP00000345456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]