SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|19743840|ref|NP_599150.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19743840|ref|NP_599150.1|
Domain Number 1 Region: 150-236
Classification Level Classification E-value
Superfamily PDB 1.24e-31
Family PDB 0.0056
Further Details:      
 
Domain Number 2 Region: 29-96
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.21e-30
Family Double-stranded RNA-binding domain (dsRBD) 0.0018
Further Details:      
 
Domain Number 3 Region: 159-222
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.42e-28
Family Double-stranded RNA-binding domain (dsRBD) 0.0003
Further Details:      
 
Domain Number 4 Region: 293-360
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000346
Family Double-stranded RNA-binding domain (dsRBD) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|19743840|ref|NP_599150.1|
Sequence length 366
Comment RISC-loading complex subunit TARBP2 isoform a [Homo sapiens]
Sequence
MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQP
NFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPE
DIPVFTAAAAATPVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTV
TQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP
DDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLK
IMAGSK
Download sequence
Identical sequences G1S7H6 H2R7F2 Q15633
ENSP00000266987 ENSNLEP00000021465 HR4698 ENSPTRP00000050292 ENSPTRP00000050292 ENSP00000266987 NP_599150.1.87134 NP_599150.1.92137 XP_003313703.1.37143 XP_003831059.1.60992 gi|19743840|ref|NP_599150.1| ENSNLEP00000021465 ENSP00000266987 9606.ENSP00000266987 5zak_B 5zal_B 5zam_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]