SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|19923076|ref|NP_612146.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19923076|ref|NP_612146.1|
Domain Number 1 Region: 151-376
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.93e-74
Family Actin/HSP70 0.000000691
Further Details:      
 
Domain Number 2 Region: 8-156
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.1e-47
Family Actin/HSP70 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|19923076|ref|NP_612146.1|
Sequence length 376
Comment actin-related protein T1 [Homo sapiens]
Sequence
MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQE
ALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIRE
KLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTK
LCMAGRDITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKELRKSRGEVLGA
YRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIVL
SGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTS
ADFKEYGTSVVQRRCF
Download sequence
Identical sequences Q8TDG2
9606.ENSP00000360165 ENSP00000360165 ENSP00000360165 gi|19923076|ref|NP_612146.1| NP_612146.1.87134 NP_612146.1.92137 ENSP00000360165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]