SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19923090|ref|NP_612147.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19923090|ref|NP_612147.1|
Domain Number 1 Region: 31-210
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-43
Family RUN domain 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|19923090|ref|NP_612147.1|
Sequence length 473
Comment RUN domain-containing protein 3B isoform a [Homo sapiens]
Sequence
MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSS
PEFNNFAAILEQILSHRLKEISQSCRWLAHLQIPLQGQVTWFGYESPRSFWDYIRVACRK
VSQNCICSIENMENVSSSRAKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVL
GEEANMLAGMLLGLNAIDFSFCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRT
LGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSES
VSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPS
PGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTL
NVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS
Download sequence
Identical sequences A0A2I3S077 G3SKQ3 Q96NL0
ENSP00000337732 NP_612147.1.87134 NP_612147.1.92137 XP_001163562.1.37143 XP_018887176.1.27298 ENSPTRP00000033134 ENSPTRP00000033134 9598.ENSPTRP00000033134 9606.ENSP00000337732 gi|19923090|ref|NP_612147.1| ENSP00000337732 ENSP00000337732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]