SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|19924156|ref|NP_604389.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19924156|ref|NP_604389.1|
Domain Number 1 Region: 77-218
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-34
Family Ankyrin repeat 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19924156|ref|NP_604389.1|
Sequence length 237
Comment DNA-binding protein RFXANK isoform b [Homo sapiens]
Sequence
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSS
PQGSSLKHSTTLTNRQRGNEVSALPATLDCDNLVNKPDERGFTPLIWASAFGEIETVRFL
LEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHV
KCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE
Download sequence
Identical sequences A0A024R7P0
NP_001265657.1.87134 NP_001265657.1.92137 NP_604389.1.87134 NP_604389.1.92137 gi|19924156|ref|NP_604389.1| ENSP00000376138 ENSP00000262804 ENSP00000376138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]