SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20270347|ref|NP_620152.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20270347|ref|NP_620152.1|
Domain Number 1 Region: 114-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-33
Family Ankyrin repeat 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20270347|ref|NP_620152.1|
Sequence length 300
Comment ankyrin repeat domain-containing protein 54 [Homo sapiens]
Sequence
MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGG
AQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANA
NDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPL
HLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQ
IIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
Download sequence
Identical sequences Q6NXT1
ENSP00000215941 gi|20270347|ref|NP_620152.1| ENSP00000215941 NP_620152.1.87134 NP_620152.1.92137 ENSP00000215941 9606.ENSP00000215941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]