SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20336242|ref|NP_000430.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20336242|ref|NP_000430.3|
Domain Number 1 Region: 120-453
Classification Level Classification E-value
Superfamily Subtilisin-like 1.3e-87
Family Subtilases 0.00000000197
Further Details:      
 
Domain Number 2 Region: 454-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-40
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 31-103
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.53e-22
Family Prohormone convertase 1 pro-domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20336242|ref|NP_000430.3|
Sequence length 753
Comment neuroendocrine convertase 1 isoform 1 preproprotein [Homo sapiens]
Sequence
MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKSPSSSSVGGRRDELEE
GAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Download sequence
Identical sequences P29120
ENSP00000308024 9606.ENSP00000308024 ENSP00000308024 gi|20336242|ref|NP_000430.3| NP_000430.3.87134 NP_000430.3.92137 ENSP00000308024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]