SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20336244|ref|NP_002585.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20336244|ref|NP_002585.2|
Domain Number 1 Region: 113-459
Classification Level Classification E-value
Superfamily Subtilisin-like 1.09e-81
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 453-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-43
Family Proprotein convertase P-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 30-101
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000000153
Family Prohormone convertase 1 pro-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20336244|ref|NP_002585.2|
Sequence length 638
Comment neuroendocrine convertase 2 isoform 1 preproprotein [Homo sapiens]
Sequence
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
Download sequence
Identical sequences P16519
ENSP00000367131 NP_002585.2.87134 NP_002585.2.92137 gi|20336244|ref|NP_002585.2| GO.39053 ENSP00000262545 9606.ENSP00000262545 ENSP00000262545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]