SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20336246|ref|NP_006191.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20336246|ref|NP_006191.2|
Domain Number 1 Region: 124-454
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-91
Family Subtilases 0.000000000969
Further Details:      
 
Domain Number 2 Region: 453-603
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-43
Family Proprotein convertase P-domain 0.0000886
Further Details:      
 
Domain Number 3 Region: 634-794
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.35e-28
Family Growth factor receptor domain 0.00019
Further Details:      
 
Domain Number 4 Region: 35-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.89e-24
Family Prohormone convertase 1 pro-domain 0.0022
Further Details:      
 
Domain Number 5 Region: 751-898
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.14e-18
Family Growth factor receptor domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20336246|ref|NP_006191.2|
Sequence length 913
Comment proprotein convertase subtilisin/kexin type 5 isoform 2 preproprotein [Homo sapiens]
Sequence
MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFI
NIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSR
AQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPD
LMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIG
GVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGR
RGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYS
SGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIR
PNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANR
LFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSV
QPYSPTNEFPKVERFRYSRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYY
YKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSHGDQCMSCKYGYFLNEETNSC
VTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQ
DCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATEESWAEGGFCMLVKKNNLCQRKV
LQQLCCKTCTFQG
Download sequence
Identical sequences ENSP00000365943 9606.ENSP00000365943 gi|20336246|ref|NP_006191.2| ENSP00000365943 NP_006191.2.87134 NP_006191.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]