SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20357578|ref|NP_620311.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20357578|ref|NP_620311.1|
Domain Number 1 Region: 60-225
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.23e-31
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 2 Region: 232-334
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.84e-22
Family Canonical RBD 0.0000256
Further Details:      
 
Domain Number 3 Region: 450-522
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000786
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20357578|ref|NP_620311.1|
Sequence length 594
Comment APOBEC1 complementation factor isoform 3 [Homo sapiens]
Sequence
MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGWDAAPP
ERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNA
IKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSA
ADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKI
LYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLD
GSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQT
YAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED
KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFL
YKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAA
TAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF
Download sequence
Identical sequences A0A024QZI9
NP_001185749.1.87134 NP_001185749.1.92137 NP_620311.1.87134 NP_620311.1.92137 gi|20357578|ref|NP_620311.1| gi|311771768|ref|NP_001185749.1| ENSP00000363107 ENSP00000363107 ENSP00000378873 ENSP00000363107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]