SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|205360943|ref|NP_005647.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|205360943|ref|NP_005647.3|
Domain Number 1 Region: 242-489
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.32e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.072
Further Details:      
 
Domain Number 3 Region: 112-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|205360943|ref|NP_005647.3|
Domain Number - Region: 5-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00732
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|205360943|ref|NP_005647.3|
Sequence length 492
Comment transmembrane protease serine 2 isoform 2 [Homo sapiens]
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIEC
DSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVF
TDWIYRQMRADG
Download sequence
Identical sequences O15393
gi|205360943|ref|NP_005647.3| ENSP00000330330 ENSP00000391216 ENSP00000330330 ENSP00000391216 NP_005647.3.87134 NP_005647.3.92137 XP_011528033.1.92137 9606.ENSP00000330330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]