SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|206597515|ref|NP_001128662.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206597515|ref|NP_001128662.1|
Domain Number 1 Region: 660-837
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 35-174
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-27
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 
Domain Number 3 Region: 371-542
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-26
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 4 Region: 290-361
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-24
Family Pyk2-associated protein beta ARF-GAP domain 0.0035
Further Details:      
 
Domain Number 5 Region: 971-1115
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000263
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 
Domain Number 6 Region: 197-291
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000428
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 557-685
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000213
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|206597515|ref|NP_001128662.1|
Domain Number - Region: 872-956
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000775
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|206597515|ref|NP_001128662.1|
Sequence length 1133
Comment arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 isoform d [Homo sapiens]
Sequence
MTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSSLSLSL
PSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKD
AYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAEQRARA
RLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGITFIDM
SVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAERIWAAA
PNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTETLIEAL
CAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNRTTEVPR
LDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGVLSYFEN
ERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHEWVKCIA
KAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQL
RKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTLSEQQLG
DSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDD
VSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALI
SHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFSVDEEEL
RKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAEELTLEI
LDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQAMEAML
LYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSHRPEKEW
PIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFATFLFVQHD
GLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFTADPLSLLRNV
Download sequence
Identical sequences ENSP00000403127 NP_001128662.1.87134 NP_001128662.1.92137 gi|206597515|ref|NP_001128662.1| ENSP00000403127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]