SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|208022658|ref|NP_001129074.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|208022658|ref|NP_001129074.1|
Domain Number 1 Region: 345-386,413-518
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-38
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.068
Further Details:      
 
Domain Number 2 Region: 105-230
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.22e-29
Family Glycosyl hydrolases family 35 catalytic domain 0.0055
Further Details:      
 
Domain Number 3 Region: 32-82
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000000109
Family Glycosyl hydrolases family 35 catalytic domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|208022658|ref|NP_001129074.1|
Sequence length 546
Comment beta-galactosidase isoform c preproprotein [Homo sapiens]
Sequence
MPGFLVRILPLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTLPGSCGQVVGSPSAQDEASPLSEWRASYNSAGSNITDA
FLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIGG
TNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPK
FAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAP
LSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYIND
FKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAF
YMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTS
APNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKD
SWLDHV
Download sequence
Identical sequences NP_001129074.1.87134 NP_001129074.1.92137 gi|208022658|ref|NP_001129074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]