SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|208431829|ref|NP_001129124.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|208431829|ref|NP_001129124.1|
Domain Number 1 Region: 256-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-52
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.34e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0000229
Further Details:      
 
Domain Number 3 Region: 88-167
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.04e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.00000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|208431829|ref|NP_001129124.1|
Sequence length 510
Comment interferon-induced, double-stranded RNA-activated protein kinase isoform b [Homo sapiens]
Sequence
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSL
ESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKG
VDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQIS
SQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSK
KPEDRPNTSEILRTLTVWKKSPEKNERHTC
Download sequence
Identical sequences NP_001129124.1.87134 NP_001129124.1.92137 ENSP00000385014 ENSP00000385014 gi|208431829|ref|NP_001129124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]