SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209862867|ref|NP_001129505.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209862867|ref|NP_001129505.1|
Domain Number 1 Region: 183-271,420-507
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.86e-28
Family Canonical RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 86-162
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.1e-22
Family Canonical RBD 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209862867|ref|NP_001129505.1|
Sequence length 516
Comment poly(U)-binding-splicing factor PUF60 isoform c [Homo sapiens]
Sequence
MENGQSTAAKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAV
TMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWD
SVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEAR
AFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDA
VSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAA
VLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPI
LASPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTV
MVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIAS
ETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Download sequence
Identical sequences A0A0D9R949 A0A2J8LG39 A0A2J8RHF2 A0A2K5ZV27
NP_001129505.1.87134 NP_001129505.1.92137 XP_004090875.1.23891 XP_005564338.1.63531 XP_008000021.1.81039 XP_008971019.1.60992 XP_011831064.1.47321 XP_011905521.1.92194 XP_015001646.1.72884 XP_015310824.1.63531 XP_016868728.1.92137 XP_017738956.1.44346 XP_017738957.1.44346 XP_017738958.1.44346 XP_018887768.1.27298 XP_018887769.1.27298 gi|209862867|ref|NP_001129505.1| ENSP00000402953 ENSMMUP00000031872 ENSP00000402953 ENSP00000454436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]