SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209915591|ref|NP_001129610.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209915591|ref|NP_001129610.1|
Domain Number 1 Region: 334-403,883-1052
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-40
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 223-321
Classification Level Classification E-value
Superfamily MIT domain 4.05e-24
Family MIT domain 0.0022
Further Details:      
 
Domain Number 3 Region: 10-114
Classification Level Classification E-value
Superfamily PX domain 2.62e-21
Family PX domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209915591|ref|NP_001129610.1|
Sequence length 1054
Comment ribosomal protein S6 kinase delta-1 isoform b [Homo sapiens]
Sequence
MTSYRERSADLARFYTVTEPQRHPRGYTVYKVTARIIVWKRYSDFKKLHKELWQIHKNLF
RHSELFPPFAKGIVFGRFDETVIEERRQCAEDLLQFSANIPALYNSKQLEDFFKGGIIND
SSELIGPAEAHSDSLIDTFPECSTEGFSSDSDLVSLTVDVDSLAELDDGMASNQNSPIRT
FGLNLSSDSSALGAVASDSEQSKTEEERESRSLFPGSLKPKLGKRDYLEKAGELIKLALK
KEEEDDYEAASDFYRKGVDLLLEGVQGESSPTRREAVKRRTAEYLMRAESISSLYGKPQL
DDVSQPPGSLSSRPLWNLRSPAEELKAFRVLGVIDKVLLVMDTRTEQTFILKGLRKSSEY
SRNRKTIIPRCVPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFLNRSPEESFDIKE
VKKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSSQDDSNQEDDGQD
SSPKWPDSGSSSEEECTTSYLTLCNEYGQEKIEPGSLNEEPFMKTEGNGVDTKAIKSFPA
HLAADSDSPSTQLRAHELKFFPNDDPEAVSSPRTSDSLSRSKNSPMEFFRIDSKDSASEL
LGLDFGEKLYSLKSEPLKPFFTLPDGDSASRSFNTSESKVEFKAQDTISRGSDDSVPVIS
FKDAAFDDVSGTDEGRPDLLVNLPGELESTREAAAMGPTKFTQTNIGIIENKLLEAPDVL
CLRLSTEQCQAHEEKGIEELSDPSGPKSYSITEKHYAQEDPRMLFVAAVDHSSSGDMSLL
PSSDPKFQGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKTEEVLLFTDQTDD
LAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFYIPEGCIQRWAAE
MVVALDALHREGIVCRDLNPNNILLNDRGHIQLTYFSRWSEVEDSCDSDAIERMYCAPEV
GAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLL
QFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR
Download sequence
Identical sequences ENSP00000355926 gi|209915591|ref|NP_001129610.1| NP_001129610.1.87134 NP_001129610.1.92137 ENSP00000355926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]