SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21245124|ref|NP_640336.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21245124|ref|NP_640336.1|
Domain Number 1 Region: 93-180
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.32e-16
Family Double-stranded RNA-binding domain (dsRBD) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21245124|ref|NP_640336.1|
Sequence length 576
Comment adenosine deaminase domain-containing protein 1 isoform 1 [Homo sapiens]
Sequence
MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNF
PEPLLSKNLSSISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTT
GNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPP
FPAEPVVLSELAYVSKVHYEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIE
RAGQHEVVAIGTGEYNYSQDIKPDGRVLHDTHAVVTARRSLLRYFYRQLLLFYSKNPAMM
EKSIFCTEPTSNLLTLKQNINICLYMNQLPKGSAQIKSQLRLNPHSISAFEANEELCLHV
AVEGKIYLTVYCPKDGVNRISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISSILIGDGN
CSDTRGLEIAIKQRVDDALTSKLPMFYLVNRPHISLVPSAYPLQMNLEYKFLSLNWAQGD
VSLEIVDGLSGKITESSPFKSGMSMASRLCKAAMLSRFNLLAKEAKKELLEAGTYHAAKC
MSASYQEAKCKLKSYLQQHGYGSWIVKSPCIEQFNM
Download sequence
Identical sequences Q96M93
NP_640336.1.87134 NP_640336.1.92137 XP_005262798.1.92137 XP_005262800.1.92137 XP_011529905.1.92137 ENSP00000373376 NYSGRC-21245124 gi|21245124|ref|NP_640336.1| ENSP00000296513 9606.ENSP00000296513 ENSP00000296513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]