SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212549546|ref|NP_001131143.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212549546|ref|NP_001131143.1|
Domain Number 1 Region: 125-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.79e-60
Family Ankyrin repeat 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212549546|ref|NP_001131143.1|
Sequence length 542
Comment POTE ankyrin domain family member C [Homo sapiens]
Sequence
MVTEVCSMPAASAVKKPFDLRSKMGKWFHHRFPCCKGSGKSNMGTSGDHDDSFMKMLRSK
MGKCCHHCFPCCRGSGTSNVGTSGDHDNSFMKTLRSKMGKWCCHCFPCCRGSGKSNVGAW
GDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKQKRTALHLA
SANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLMLLEHGADQNIPDEYGN
TTLHYAVHNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK
KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQL
SEEQNTGISQDEILTNKQKQIEVAEKKMNSELSLSHKKEEDLLRENSMLQEEIAMLISGD
WN
Download sequence
Identical sequences B2RU33
ENSP00000421410 NP_001131143.1.87134 NP_001131143.1.92137 ENSP00000351856 9606.ENSP00000351856 gi|212549546|ref|NP_001131143.1| ENSP00000351856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]