SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212549553|ref|NP_060090.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212549553|ref|NP_060090.2|
Domain Number 1 Region: 524-594
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.43e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00032
Further Details:      
 
Domain Number 2 Region: 396-467
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.05e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212549553|ref|NP_060090.2|
Sequence length 898
Comment interleukin enhancer-binding factor 3 isoform d [Homo sapiens]
Sequence
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQA
ESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKP
TTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEM
EKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRV
PTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIP
PSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGE
DSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVKQQGPILTKHGKNPVMELNEKR
RGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLAL
DANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRG
FGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSY
YQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKG
YNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGY
GGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR
Download sequence
Identical sequences gi|212549553|ref|NP_060090.2| ENSP00000250241 NP_060090.2.87134 NP_060090.2.92137 XP_011526286.2.92137 XP_016882252.1.92137 ENSP00000404121 ENSP00000468181 9606.ENSP00000404121 ENSP00000404121 ENSP00000468181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]