SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212549555|ref|NP_001131145.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212549555|ref|NP_001131145.1|
Domain Number 1 Region: 524-594
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.91e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00032
Further Details:      
 
Domain Number 2 Region: 396-467
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.7e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212549555|ref|NP_001131145.1|
Sequence length 706
Comment interleukin enhancer-binding factor 3 isoform e [Homo sapiens]
Sequence
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQA
ESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKP
TTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEM
EKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRV
PTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIP
PSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGE
DSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVKQQGPILTKHGKNPVMELNEKR
RGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLAL
DANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRG
FGGANHGGYMNAGAGYGSYGYGGNSATAGYSDFFTDCYGYHDFGSS
Download sequence
Identical sequences ENSP00000384660 gi|212549555|ref|NP_001131145.1| NP_001131145.1.87134 NP_001131145.1.92137 ENSP00000384660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]