SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213417911|ref|NP_001132989.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213417911|ref|NP_001132989.1|
Domain Number 1 Region: 112-189
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.29e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00013
Further Details:      
 
Domain Number 2 Region: 20-89
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.34e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0000294
Further Details:      
 
Domain Number 3 Region: 218-296
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000109
Family Double-stranded RNA-binding domain (dsRBD) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213417911|ref|NP_001132989.1|
Sequence length 302
Comment interferon-inducible double stranded RNA-dependent protein kinase activator A isoform 2 [Homo sapiens]
Sequence
MQSTPFCGFCSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVT
VGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSL
QELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAK
FSNISPENHISLTNVVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKE
QGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAE
RK
Download sequence
Identical sequences A0A2J8VRF3 K7C291
ENSP00000393883 gi|213417911|ref|NP_001132989.1| NP_001132989.1.87134 NP_001132989.1.92137 ENSP00000393883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]